PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C013627P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family bHLH
Protein Properties Length: 140aa    MW: 15954.1 Da    PI: 6.8105
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C013627P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH13.90.00011401655
                    HHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
             HLH 16 iNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                    ++s +++L +llP+  ++++   +  +  e A++YIksL+
  MELO3C013627P1  1 MKSLYSKLNSLLPSHHSNDQLPRTVTDQIEAAINYIKSLE 40
                    6899**********65666666888999**********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474592.76E-5158IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 140 aa     Download sequence    Send to blast
MKSLYSKLNS LLPSHHSNDQ LPRTVTDQIE AAINYIKSLE IKLKQDEEKK ERYLRRSKIA  60
SSSTASSSSY SALSISQNRN VPELKIKEMG SAVEVVLKTG LEDRSMFYET IRILNEERAE  120
IINVSYSLLD DTILYSLHAE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819180.0LN681918.1 Cucumis melo genomic scaffold, anchoredscaffold00020.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF9063498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G20970.17e-24bHLH family protein